RECOVERING SEQUENCES FROM GENBANK
1. Recovering sequence from GenBank
1. Recovering sequences from GenBank
(i) Formulate a search strategy at NCBI selecting the appropriate "Search" database "Protein" in this case and press "Go":
(ii) The results will look like this:
(iii) If you are interested in the descriptive file and the sequence click on the GenBank protein accession number (e.g. NP_112054).
(iv) If all you want is the protein sequence change the "Display" to "Fasta" and click on "Display" to get:
(v) Use the Copy/Paste feature of your browser to transfer this data to Notepad.
2. Downloading a series of homologs
If you want to obtain a text file with a variety of homologs to a particular protein one can proceed as outlined in Section 1 or following a BLASTP search.
Protein sequence:
>gi|9634197|ref|NP_037736.1| Cro protein [Bacteriophage HK97]
MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRNIFLTINADGSVYAEEVKPFPSNKKTTA
(i) Initiate a BLASTP search (ii) Here are the results (trimmed for easy of viewing:
(iii) Click on the boxes to the left of the sequences which you want to recover and the "Get selected sequences" button to get to the following page:
(iv) Again click on the boxes adjacent to the desired sequences and change "Display" to "FASTA" and click on "Display" to give the following:
(v) Use the Copy/Paste feature of your browser to transfer this data to Notepad.
