NCBI Nucleotide banner
PubMed Nucleotide Protein Genome Structure PopSet Taxonomy OMIM Books
 Search for
  Limits Preview/Index History Clipboard Details
You need JavaScript to work with this page.
   
1: AJ420859. Zea mays tua5 gen...[gi:18157219] Related Sequences, Protein, Taxonomy
LOCUS       ZMA420859               3674 bp    DNA     linear   PLN 14-JAN-2002
DEFINITION  Zea mays tua5 gene for alpha tubulin, exons 1-5.
ACCESSION   AJ420859
VERSION     AJ420859.1  GI:18157219
KEYWORDS    alpha tubulin; tua5 gene.
SOURCE      Zea mays.
  ORGANISM  Zea mays
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; PACC
            clade; Panicoideae; Andropogoneae; Zea.
REFERENCE   1
  AUTHORS   Hussien Abou-Deif,M.
  TITLE     Characterization of new genes coding for alpha-tubulin in maize
  JOURNAL   Thesis (2001) Department of Genetica Molecular, Ibmb-csic,
            Barcelona, Spain
REFERENCE   2
  AUTHORS   Hussien Abou-Deif,M.
  TITLE     Characterization of new genes coding for alpha-tubulin in maize
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 3674)
  AUTHORS   Rigau,J.
  TITLE     Direct Submission
  JOURNAL   Submitted (21-NOV-2001) Rigau J., Genetica Molecular,
            Ibmb-cid-csic, Jordi Girona 18-26., Barcelona 08034, SPAIN
FEATURES             Location/Qualifiers
     source          1..3674
                     /organism="Zea mays"
                     /cultivar="W64A"
                     /db_xref="taxon:4577"
                     /tissue_type="seedlings"
                     /clone_lib="lambda FIX II"
     gene            159..3407
                     /gene="tua5"
     TATA_signal     159..164
                     /gene="tua5"
     CDS             join(300..412,1234..1447,1539..1739,2344..2852,2965..3280)
                     /gene="tua5"
                     /function="microtubule component"
                     /codon_start=1
                     /product="alpha tubulin"
                     /protein_id="CAD20822.1"
                     /db_xref="GI:18157220"
                     /translation="MREIISIHIGQAGIQVGNACWELYCLEHGIEHDGTMPSDSSVGV
                     AHDAFNTFFSETGSGKHVPRAIFVDLEPTVIDEVRTGSYRQLFHPEQLISGKEDAANN
                     FARGHYTVGKEIVDLCLDRVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVD
                     YGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLD
                     IERPTYTNLNRLISQIISSLTTSLRFDGAINVDVTEFQTNLVPYPRIHFMLSSYAPVI
                     SAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVAT
                     IKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNTAVAEVFSRID
                     HKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGAEGADDEGDEGDDY
                     "
     exon            300..412
                     /gene="tua5"
                     /number=1
     intron          413..1233
                     /gene="tua5"
                     /number=1
     exon            1234..1447
                     /gene="tua5"
                     /number=2
     intron          1448..1538
                     /gene="tua5"
                     /number=2
     exon            1539..1739
                     /gene="tua5"
                     /number=3
     intron          1740..2343
                     /gene="tua5"
                     /number=3
     exon            2344..2852
                     /gene="tua5"
                     /number=4
     intron          2853..2964
                     /gene="tua5"
                     /number=4
     exon            2965..3280
                     /gene="tua5"
                     /number=5
     polyA_signal    3291..3295
                     /gene="tua5"
     polyA_signal    3402..3407
                     /gene="tua5"
BASE COUNT      839 a    838 c    911 g   1086 t
ORIGIN      
        1 tacggacggg agaagcgcgc gggcgggccg gccggcctca cgtgaacaac gcccgcccac
       61 gaaacgcgct ggctgtgcaa aagcaaccgt ttccagtttc ctccccagtg caccccctcc
      121 cctctcccct ccctctctct cctccggccc ccttttttta tgcccgatct cacacatttt
      181 ggaaggagag agagagaggc agagggagag attggaggga ggcccctgcc gtaggcaaga
      241 gaaaccgcgg cgcgcggaga gggaggaagg gcagacgcag acgcagacgg gcgaacaaga
      301 tgagggagat catcagcatc cacatcggcc aggccgggat ccaggtcggc aacgcctgct
      361 gggagctcta ctgcctcgag cacggcatcg agcacgatgg caccatgccc aggtgagtgc
      421 tgcatgccct gtcgatccgc cgggacgcgc tcctcctgtt tacccatttt ttgcagctta
      481 aagctgttgc gcgttctatg gagccggcgc atcaaaattc tggcgtgctc attcgtcgca
      541 tttcctagat tcgctgcgtt gttttcttcc aattcgtcgg agcaaatgac ggggcgtgta
      601 ggtgtagtga tggtacttcc atatccgttt cgtatttttt ggttcgtctg tccctttccg
      661 ttgcactcgc agttttggtt cctttgcgac tggatttgtt tgttgggtgg gatgtgttgt
      721 tgttgttgtc tgtttgggtt ttggtgcatt ttgccggttg ttcgagagat tgctatgagc
      781 cgggaccaga tgccacgttt cctaattaag agtttgcgct agcgtttttt ttttggacta
      841 ttaatactag gcctgttaat taggcaggcg ccacagaagg atgcgttgag ctctgaagaa
      901 ttgaatctgc agggatgtca tctaaataaa taatataact gggatgttct gatgagtgtc
      961 agaccatgga tctccctgga ttcacgagtt tcatctgacc ctttgtaaaa agtagcaccc
     1021 ttctctctgt ttgcctgatc ttgtagtacc atagaaaatt gccctaatgc tgctccgcct
     1081 gataatagaa aaaatcctgt tttaggaccc caaggaggca ggtttcgtag gctataaatt
     1141 ctctttaagc gcatatgcca atggttcgtg ccttattgtt attggagttc catgctatcc
     1201 attttttata acactggttt gattgtgatg cagtgattcc tcggttggcg tcgcacatga
     1261 tgccttcaac acgttcttca gcgagactgg ttccggcaag catgtgccca gggccatctt
     1321 cgtcgacctt gagcccactg tcatcgacga ggttcgcact ggctcgtacc gccagctctt
     1381 ccacccagag cagctcatct cggggaagga ggatgcagct aacaactttg cccgtggcca
     1441 ctacacggta attcaccttg tgtctgaata gataatagga gtgggtccta tgcttctgca
     1501 actgtggaaa tgttcaattc taattatggt gcaatgcagt tgggaaggag attgtcgatc
     1561 tatgcctgga ccgtgtgcgc aagcttgcag acaactgcac tgggctgcag ggattcttgg
     1621 tgttcaatgc tgttggtggt ggtactggct ctggacttgg ttcactgctg ttggagcgcc
     1681 tttcagttga ttatggcaag aagtctaagc ttggtttcac catttatcct tccccacagg
     1741 tatgacctta tgacagaacc ttacattagc aacctagttt ctgtggattt cacacaaaaa
     1801 tatattcata taattattct ttccaaaagg agtttggctt aagtatatga gaattgtaaa
     1861 acatacatga agtattaggt tgacaattta tatttataca ccaacatgaa atttttttat
     1921 atgtaaatta atctacggat tatgcaattt ggtggcactg tccttgcctt caaaattaca
     1981 gacagagcac tgattattgg atcagcctag cattatataa atcatgtgtg gaacaaaaca
     2041 agcaactgtt gtgaacttat ggttagtgag accttcttgt atattgttta gaccatggtt
     2101 agtacagctg tcacagtctt caggtcttct ttatgagtgt ctttaaatca tgcattgcat
     2161 atgtgccagc attatcctat agtgctgctc cttcctgtcc atgtgatgtg gtccattcat
     2221 cttgttcatg tgagtaggtt ttctgcatct tagctgttgt ggggaaaagt gggtagagat
     2281 gttcgatgaa tttggatctg atccatcatt taacttttca tgtaacgcca ctctggaatg
     2341 caggtgtcaa cagctgttgt agagccatac aacagtgtcc tctcgaccca ctccttgctc
     2401 gagcacactg atgttgcagt cctcctggac aacgaggcta tctatgacat atgcaggagg
     2461 tcccttgaca tcgaaaggcc aacctatacc aacttgaaca ggctgatctc acagatcata
     2521 tcatcactta ccacctccct gaggtttgat ggggctatca atgtggatgt tactgagttc
     2581 cagaccaacc ttgttccata cccacgtatt catttcatgc tttcctcata tgcccctgta
     2641 atatctgctg agaaggccta ccatgagcag ctctctgtgc ctgaaatcac caatgctgta
     2701 tttgagccct caagcatgat ggccaagtgt gacccaaggc acggaaagta catggcttgc
     2761 tgcttgatgt accgcggtga tgttgttcct aaggatgtca acgctgcagt tgcaaccatc
     2821 aagaccaaga gaactgtcca gtttgtggac tggtaagatg tctttgtcgc atttgagttg
     2881 tgcttattct atgatatcac atgcttgtca cttgattcgc gatggtaagt gggtaactaa
     2941 ttcaattatg ctgtcgccac acaggtgccc cactggattc aagtgtggca tcaactatca
     3001 gccaccctct gttgtccctg gaggtgacct ggcaaaggtc cagcgtgccg tgtgcatgat
     3061 cagcaacaac accgccgttg ccgaggtgtt ttcacgcatc gaccacaagt ttgaccttat
     3121 gtacgccaag cgcgcattcg ttcactggta tgtcggtgag ggtatggaag agggtgagtt
     3181 ctcagaagcc cgtgaggact tggctgctct tgagaaggac tatgaggaag tcggtgcaga
     3241 gggtgccgat gacgagggtg acgagggaga cgactattga atagctggct aataagtagt
     3301 tctctggtgg ttaatggttg gactattttg gagctatata ctctatggct ccactccatt
     3361 ggatactgct gctggttgtg tgtttccatt ttgtactatg tagtaaattg ttcgtaaccc
     3421 ccctattggc catgattgtt ccatatcatc cttctttgcg tttgcaacgc tattcgtcca
     3481 atttccggtg tatatgctat aatgctatta tgttgcaagt gtgctgtgct caaccattgg
     3541 gttttattta tatttagaaa cagaaggcat tattactctt cgctgaagct tgtttctgaa
     3601 tcaggggaac attgagattt tgagaagttt tgacagcagt ctaccactgt gagggcctaa
     3661 ggatcccacg ggag
//