NCBI Nucleotide banner
PubMed Nucleotide Protein Genome Structure PopSet Taxonomy OMIM Books
 Search for
  Limits Preview/Index History Clipboard Details
   
1: M94250. Human retinoic ac...[gi:188570] MapView, Related Sequences, OMIM, Protein, PubMed, SNP, Taxonomy, UniSTS, LinkOut
LOCUS       HUMMKXX                 3308 bp    DNA     linear   PRI 07-JAN-1995
DEFINITION  Human retinoic acid inducible factor (MK) gene exons 1-5, complete
            cds.
ACCESSION   M94250
VERSION     M94250.1  GI:188570
KEYWORDS    retinoic acid inducible factor.
SOURCE      Homo sapiens (tissue library: FIXII, Stratagene catalog #946203)
            placenta DNA.
  ORGANISM  Homo sapiens
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Primates; Catarrhini; Hominidae; Homo.
REFERENCE   1  (bases 1 to 3308)
  AUTHORS   Fairhurst,J.L., Kretschmer,P.J., Kovacs,E., Bohlen,P. and
            Kovesdi,I.
  TITLE     Structure of the gene coding for the human retinoic acid-inducible
            factor, MK
  JOURNAL   DNA Cell Biol. 12 (2), 139-147 (1993)
  MEDLINE   93228828
   PUBMED   8471163
FEATURES             Location/Qualifiers
     source          1..3308
                     /organism="Homo sapiens"
                     /db_xref="taxon:9606"
                     /tissue_type="placenta"
                     /tissue_lib="FIXII, Stratagene catalog #946203"
     prim_transcript 994..3091
                     /gene="MK"
     exon            994..1039
                     /gene="MK"
                     /number=1
     intron          1040..1337
                     /gene="MK"
                     /number=1
     exon            1338..1414
                     /gene="MK"
                     /number=2
     gene            join(1339..1414,1569..1736,1857..2018,2736..2761)
                     /gene="MK"
     CDS             join(1339..1414,1569..1736,1857..2018,2736..2761)
                     /gene="MK"
                     /codon_start=1
                     /product="retinoic acid inducible factor"
                     /protein_id="AAA59850.1"
                     /db_xref="GI:188571"
                     /translation="MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGP
                     CTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKV
                     RQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD"
     sig_peptide     1339..1404
                     /gene="MK"
     mat_peptide     join(1405..1414,1569..1736,1857..2018,2736..2758)
                     /gene="MK"
                     /product="retinoic acid inducible factor"
     intron          1415..1568
                     /gene="MK"
                     /number=2
     exon            1569..1736
                     /gene="MK"
                     /number=3
     intron          1737..1856
                     /gene="MK"
                     /number=3
     exon            1857..2018
                     /gene="MK"
                     /number=4
     intron          2019..2735
                     /gene="MK"
                     /number=4
     exon            2736..3091
                     /gene="MK"
                     /number=5
     polyA_signal    3044..3049
                     /gene="MK"
     polyA_signal    3066..3071
                     /gene="MK"
     polyA_site      3091
BASE COUNT      602 a    997 c   1169 g    540 t
ORIGIN      
        1 ggcggccgcg ctcgtcgggg ccgggggcgg ggccgatccc tccggcttcc cgcttcccgc
       61 ggagaacaac aatgaaagtg aaagaggggt ggggcggggg cgagcccggg ttctgtggcc
      121 catttgccct gtggccttga gcaagcccct cccccaggcc tcgggggctc tcccggtttg
      181 ggggaaccgg gcgaggcaat gccacaggcc cagggttaga gggggtgggc acttgcagct
      241 gccgatgtgg ctggatctgg aacttctcgg agacggctcc tgtcagcgcc aagtttcacc
      301 aaatccaggc ctgcccctcc tcccccagga cccccactcg cagtccctca agcctgtgct
      361 cccggaaagg cactgggcga ccgcacccgt ggctttctct gggcgaccgg gtcccagact
      421 ccccccagca cagcagagcg cttccctgcc caccccggaa accgccccag gtggccgcgc
      481 cccctcccca gcagccagca gggcgccagg gctgagccgg ccgtggaggg gagcgggtcc
      541 cgcggttata caggcgccgg ggctccgcgg caggcaagag aagctgaggc ctgagaacgg
      601 cccaaacctt ggcgtacggc aggggacgac ctgggatggg ggcagcgggc ggcggcgcag
      661 ggagtgggcc gggggccggt gtgcgcgggc gggacggggc ccggggtcgg gagacaccgc
      721 ttggaagatg gggccgggag aggcgccgtc gcagcgcaga gggcaccggc ggggagacgc
      781 gaggacgcgg ggcccgggaa cacggacgcc ggagtagaag cgcggggggc cgggctggag
      841 cgggggcggg gacgcggggg tcgggggcgg tgcgggtttg aggggagggg gcgggcgggt
      901 ccttccctgg gggggtgggg agagggggcg ggggcccatg tgaccggctc agaccgttct
      961 ggagacaaaa ggggccgcgg cggccggagc gggacgggcc cggcgcggga gggagcgaag
     1021 cagcgcgggc agcgagcgag tgagcgcgcg gcgggcccct ggtccgccgg cccgcggccg
     1081 atctaggggc tgggggctgg aggcggggtg ggggtctgag ctgcgtcctg ggctcgaggc
     1141 gtcccccggg ggagtcgcct cttagcggtg cgtccgggct agcggcgagg ggccgcccca
     1201 agtcttccca ccgccgccac cttagcagcc cgacttgggg cctggaaagt ggagcacgcg
     1261 gaggtgggag ggccctgcac gcggccccgg tgggaaaggg gacgggccag ggattcagac
     1321 tcgggctctc ccctcaggat gcagcaccga ggcttcctcc tcctcaccct cctcgcccta
     1381 ctggcgctca cctccgcggt cgccaaaaag aaaggtgatg ggggatgatc gaaggagggc
     1441 tggggacggg caggcaggcc cctccacttc tggctggccg cctggttcct agcctggaac
     1501 ccaggaaggc ggctcccgag ggagtctccc cgtgccccag tcctgaactc tgttcctcgc
     1561 gcgtgtagat aaggtgaaga agggcggccc ggggagcgag tgcgctgagt gggcctgggg
     1621 gccctgcacc cccagcagca aggattgcgg cgtgggtttc cgcgagggca cctgcggggc
     1681 ccagacccag cgcatccggt gcagggtgcc ctgcaactgg aagaaggagt ttggaggtag
     1741 gcgggcgcag tcagagggca gagacggggg cacagcctcg ccgaagcctg ggcggaccct
     1801 tggcggaggg cggggccgcg ggcgcgcagc gctgacctgg gccgctctct cgccagccga
     1861 ctgcaagtac aagtttgaga actggggtgc gtgtgatggg ggcacaggca ccaaagtccg
     1921 ccaaggcacc ctgaagaagg cgcgctacaa tgctcagtgc caggagacca tccgcgtcac
     1981 caagccctgc acccccaaga ccaaagcaaa ggccaaaggt cagcgaaagg agaagggggt
     2041 ggggctgtcg cggggggctg cccccccccc cccgcctgtg aggggacaat tccaagttaa
     2101 accttaagtt ttgagtcctg gccagtggct tcctgacatc gcctcacttg gcttccctgc
     2161 ctggaaaagt ctgaagatgg gcactacaag agaggccgca ggtgatgctg gggacataaa
     2221 tcctccctgg cccaaatagg gaccaactca aactactcca ttggagcatc tggcttagga
     2281 cccagggaga gagtcctgga acggcttgcc tttggtcagc tctccagcca cgggcagcat
     2341 ttggtcagct ctgccctttc tagtgttggg aggaggtcaa ggcccaccct gggcctctca
     2401 gctcactcgt gactcagccc agcgaggcca gcagggcagg ggtgaatctg cccgcttctc
     2461 aggtgaggag gctgaggatg cccagggctg ctgtgaccag gactaggact ggaaacttga
     2521 aggttttctg atcccaagtg gaaataggaa gctggggatg tcccatgtcc acatcacaat
     2581 ggctgcccca tcccctgctt ccgagtcagc tgattggaaa ccactagggg cagatcttct
     2641 ccttccctga tgcccgggtg tttgtggagc cggcggtctg caatgggtca gcctaactgc
     2701 tgatatggta ttaatatttc tttcttgttt tacagccaag aaagggaagg gaaaggacta
     2761 gacgccaagc ctggatgcca aggagcccct ggtgtcacat ggggcctggc cacgccctcc
     2821 ctctcccagg cccgagatgt gacccaccag tgccttctgt ctgctcgtta gctttaatca
     2881 atcatgccct gccttgtccc tctcactccc cagccccacc cctaagtgcc caaagtgggg
     2941 agggacaagg gattctggga agcttgagcc tcccccaaag caatgtgagt cccagagccc
     3001 gcttttgttc ttccccacaa ttccattact aagaaacaca tcaaataaac tgactttttc
     3061 cccccaataa aagctcttct tttttaatat aaagcccctt cccaaggagt ttgctgtgga
     3121 aatgtgtttg ggagtgggaa ggtggggaga aagaccaggc tgtagggact ggtgggtttc
     3181 agggggcttg gtggtgggtg ctctccagag ctcatggaaa aagcagaaca attacaacat
     3241 ttcttccagg gcccctgaaa ggtgctcccc atcaagtcac ctaagccttt cggtcctcat
     3301 ctccctca
//