NCBI Nucleotide banner
PubMed Nucleotide Protein Genome Structure PopSet Taxonomy OMIM Books
 Search for
  Limits Preview/Index History Clipboard Details
   
1: AJ132715. Drosophila melano...[gi:4220555] Related Sequences, Protein, PubMed, Taxonomy, LinkOut
LOCUS       DME132715               5937 bp    DNA     linear   INV 04-FEB-2000
DEFINITION  Drosophila melanogaster GMII gene, exons 1-5.
ACCESSION   AJ132715
VERSION     AJ132715.1  GI:4220555
KEYWORDS    alpha-mannosidase II; GMII gene.
SOURCE      fruit fly.
  ORGANISM  Drosophila melanogaster
            Eukaryota; Metazoa; Arthropoda; Hexapoda; Insecta; Pterygota;
            Neoptera; Endopterygota; Diptera; Brachycera; Muscomorpha;
            Ephydroidea; Drosophilidae; Drosophila.
REFERENCE   1  (bases 1 to 5937)
  AUTHORS   Rabouille,C., Kuntz,D.A., Lockyer,A., Watson,R., Signorelli,T.,
            Rose,D.R., van den Heuvel,M. and Roberts,D.B.
  TITLE     The Drosophila GMII gene encodes a Golgi alpha-mannosidase II
  JOURNAL   J. Cell. Sci. 112 (Pt 19), 3319-3330 (1999)
  MEDLINE   99436189
REFERENCE   2  (bases 1 to 5937)
  AUTHORS   Roberts,D.B.
  TITLE     Direct Submission
  JOURNAL   Submitted (01-FEB-1999) Roberts D.B., Genetics Unit, Biochemistry
            Department, Oxford University, South Parks Road, Oxford, OX1 3QU,
            UNITED KINGDOM
FEATURES             Location/Qualifiers
     source          1..5937
                     /organism="Drosophila melanogaster"
                     /db_xref="taxon:7227"
     gene            700..5345
                     /gene="GMII"
     mRNA            join(<700..912,969..1495,1828..3300,3535..4597,
                     4695..>5345)
                     /gene="GMII"
     exon            700..912
                     /gene="GMII"
                     /number=1
     CDS             join(799..912,969..1495,1828..3300,3535..4597,4695..4844)
                     /gene="GMII"
                     /EC_number="3.2.1.114"
                     /function="N-linked glycosylation"
                     /codon_start=1
                     /product="alpha-mannosidase II"
                     /protein_id="CAA10755.1"
                     /db_xref="GI:4220556"
                     /db_xref="FLYBASE:FBgn0011740;"
                     /translation="MLRIRRRFALVICSGCLLVFLSLYIILNFAAPAATQIKPNYENI
                     ENKLHELENGLQEHGEEMRNLRARLAETSNRDDPIRPPLKVARSPRPGQCQDVVQDVP
                     NVDVQMLELYDRMSFKDIDGGVWKQGWNIKYDPLKYNAHHKLKVFVVPHSHNDPGWIQ
                     TFEEYYQHDTKHILSNALRHLHDNPEMKFIWAEISYFARFYHDLGENKKLQMKSIVKN
                     GQLEFVTGGWVMPDEANSHWRNVLLQLTEGQTWLKQFMNVTPTASWAIDPFGHSPTMP
                     YILQKSGFKNMLIQRTHYSVKKELAQQRHVEFLWRQIWDNKGDTALFTHMMPFYSYDI
                     PHTCGPDPKVCCQFDFKRMGSFGLSCPWKVPPRTISDQNVAARSDLLVDQWKKKAELY
                     RTNVVLIPLGDDFRFKQNTEWDVQRVNYERLFEHINSQAHFNVQAQFGTLQEYFDAVH
                     QAERAGQAEFPTLSGDFFTYADRSDNYWSGYYTSRPYHKRMDRVLMHYVRAAEMLSAW
                     HSWDGMARIEERLEQARRELSLFQHHDGITGTAKTHVVVDYEQRMQEALKACQMVMQQ
                     SVYRLLTKPSIYSPDFSFSYFTLDDSRWPGSGVEDSRTTIILGEDILPSKHVVMHNTL
                     PHWREQLVDFYVSSPFVSVTDLANNPVEAQVSPVWSWHHDTLTKTIHPQGSTTKYRII
                     FKARVPPMGLATYVLTISDSKPEHTSYASNLLLRKNPTSLPLGQYPEDVKFGDPREIS
                     LRVGNGPTLAFSEQGLLKSIQLTQDSPHVPVHFKFLKYGVRSHGDRSGAYLFLPNGPA
                     SPVELGQPVVLVTKGKLESSVSVGLPSVVHQTIMRGGAPEIRNLVDIGSLDNTEIVMR
                     LETHIDSGDIFYTDLNGLQFIKRRRLDKLPLQANYYPIPSGMFIEDANTRLTLLTGQP
                     LGGSSLASGELEIMQDRRLASDDERGLGQGVLDNKPVLHIYRLVLEKVNNCVRPSELH
                     PAGYLTSAAHKASQSLLDPLDKFIFAENEWIGAQGQFGGDHPSAREDLDVSVMRRLTK
                     SSAKTQRVGYVLHRTNLMQCGTPEEHTQKLDVCHLLPNVARCERTTLTFLQNLEHLDG
                     MVAPEVCPMETAAYVSSHSS"
     intron          913..968
                     /gene="GMII"
                     /number=1
     exon            969..1495
                     /gene="GMII"
                     /number=2
     intron          1496..1827
                     /gene="GMII"
                     /number=2
     exon            1828..3300
                     /gene="GMII"
                     /number=3
     intron          3301..3534
                     /gene="GMII"
                     /number=3
     exon            3535..4597
                     /gene="GMII"
                     /number=4
     intron          4598..4694
                     /gene="GMII"
                     /number=4
     exon            4695..5345
                     /gene="GMII"
                     /number=5
BASE COUNT     1654 a   1340 c   1327 g   1616 t
ORIGIN      
        1 aattcccatc ttttggcctc cgttggtgac tccagggaat cgaacacggc ggctccaatt
       61 aaaagatagg tgaaagtgca taccaccagg gaaagggtac ggacattctg tcgcttcatc
      121 atatagtctc aaatataatc actacgatct ataatcaatt aatatatttt gcaccacgcg
      181 cctttttcgt tcagttaaag atgctgcgtc tgacaaaatc gatagttgtc agcaaaacaa
      241 acacacagca tccgccaaaa atggttgatt tcggttacag tggccgaata acatatgata
      301 caatgaattt taaaaatttc atcattcttt aaatatgtaa taagttttct tttatctatt
      361 gatttgaccg ttaatctcaa taaaggattg tgattttacc gttagtttat cacaacagaa
      421 gcaacagaat ttgatggcgt tgccacttgg cggtatctgt taactctgta cagctaaaaa
      481 gctgtaatgt cacgataact aaggataata ataatttttt taaaggatca atatacacaa
      541 acaacataag agttttatta cattttcttt aattgccttt aaagtttttg tctttctaag
      601 ccattttaac aatttaacat tttgcagtta gcagcgccga taacttgaca gcctatcgat
      661 tttcgggaaa agcaaacata tcgccagatc tgatttgttt atgctaaaaa aaaaccacgc
      721 aagttccaac cgattggatt gttgcagttg gctgctgtgt ctctgacgtc gacgtttcca
      781 tgcttaatta accggaaaat gttgcgaata cgtcggcggt tcgctttggt aatttgctcc
      841 ggctgcctgc tggttttcct cagcctgtac ataatcctca attttgcggc gccggcagcc
      901 acccagataa aggtaaataa atgcttctaa atcaattcga atgtataata acttctttat
      961 tttagcagcc caactatgag aacattgaga acaagctgca tgagctggaa aatggtttgc
     1021 aggagcacgg ggaggagatg cggaatctca gggcgcgtct tgccgaaaca tccaatcgcg
     1081 acgatccaat aagacctcca cttaaagtgg ctcgttcccc gaggccaggg caatgccaag
     1141 atgtggtcca agacgtgccc aatgtggatg tacagatgct ggagctatac gatcgcatgt
     1201 ccttcaagga catagatgga ggcgtgtgga aacagggctg gaacattaag tacgatccac
     1261 tgaagtacaa cgcccatcac aaactaaaag tcttcgttgt gccgcactcg cacaacgatc
     1321 ctggatggat tcagacgttt gaggaatact accagcacga caccaagcac atcctgtcca
     1381 atgcactacg gcatctgcac gacaatcccg agatgaagtt catctgggcg gaaatctcct
     1441 actttgctcg gttctatcac gatttgggag agaacaaaaa gctgcagatg aagtcgtaag
     1501 catgctttcc ctatatagta ttgatacaat aatgaataac ggtagttaac ccacaaaaca
     1561 aagtgcaatg ccattttgct attgcattcc ataaacctta cacagttgtt atgtgcagca
     1621 gtgaaatatt ttacttcgtt attgcgtcaa aagcgtttag ataaacaaaa tgcatgatca
     1681 cgctgcttgt tttccgaaac agctttgtac ttatctacct aatatttata acccaaagca
     1741 gaaataggaa ttgataagct ttgcagtctc aacaactaca atatttagtt tttaacaaaa
     1801 aataataaat tatttactta tttacagcat tgtaaagaat ggacagttgg aatttgtgac
     1861 tggaggatgg gtaatgccgg acgaggccaa ctcccactgg cgaaacgtac tgctgcagct
     1921 gaccgaaggg caaacatggt tgaagcaatt catgaatgtc acacccactg cttcctgggc
     1981 catcgatccc ttcggacaca gtcccactat gccgtacatt ttgcagaaga gtggtttcaa
     2041 gaatatgctt atccaaagga cgcactattc ggttaagaag gaactggccc aacagcgaca
     2101 cgttgagttc ctgtggcgcc agatctggga caacaaaggg gacacagctc tcttcaccca
     2161 catgatgccc ttctactcgt acgacattcc tcacacctgt ggtccagatc ccaaggtttg
     2221 ctgtcagttc gatttcaaac gaatgggctc cttcggtttg agctgtccat ggaaggtgcc
     2281 gccgcgtaca atcagtgatc aaaatgtggc agcacgctca gatctgctgg ttgatcagtg
     2341 gaagaagaag gccgagctgt atcgcacgaa cgtcgtgctg attccgttgg gtgacgactt
     2401 ccgcttcaag cagaacaccg agtgggatgt gcagcgcgtg aactacgaaa ggctgttcga
     2461 acacatcaac agccaggccc acttcaatgt ccaggcgcag ttcggcacac tgcaggaata
     2521 ctttgatgca gtgcaccagg cggaaagggc gggacaagcc gagtttccca cgctaagcgg
     2581 tgactttttc acatacgccg atcgatcgga taactattgg agtggctact acacatcccg
     2641 cccgtatcat aagcgcatgg accgcgtcct gatgcactat gtacgtgcag cagaaatgct
     2701 ttccgcctgg cactcctggg acggtatggc ccgcatcgag gaacgtctgg agcaggcccg
     2761 cagggagctg tcattgttcc agcaccacga cggtataact ggcacagcaa aaacgcacgt
     2821 agtcgtcgac tacgagcaac gcatgcagga agctttaaaa gcctgtcaaa tggtaatgca
     2881 acagtcggtc taccgattgc tgacaaagcc ctccatctac agtccggact tcagtttctc
     2941 gtactttacg ctcgacgact cccgctggcc aggatctggt gtggaggaca gtcgaaccac
     3001 cataatactg ggcgaggata tactgccctc caagcatgtg gtgatgcaca acaccctgcc
     3061 ccactggcgg gagcagctgg tggactttta tgtatccagt ccgtttgtaa gcgttaccga
     3121 cttggcaaac aatccggtgg aggctcaggt gtccccggtg tggagctggc accacgacac
     3181 actcacaaag actatccacc cacaaggctc caccaccaag taccgcatca tcttcaaggc
     3241 tcgggtgccg cccatgggct tggccaccta cgttttaacc atctccgatt ccaagccaga
     3301 gtgagtagcc agttaaagat tacccattta tcaaaggaac aagaatcctt tccgtacttt
     3361 ctgtattaat tgtacatttt cgtaacacgt ttcgctatgc cgtttcctta aaccattata
     3421 gagtgcaggt tttatttatt gatattaata tttcattaac cagatgccgt aattgtcttc
     3481 tatttatact atttatttat actttttcaa taagcatttc aatgttactt acaggcacac
     3541 ctcgtatgca tcgaatctct tgctccgtaa aaacccgact tcgttaccat tgggccaata
     3601 tccggaggat gtgaagtttg gcgatcctcg agagatctca ttgcgggttg gtaacggacc
     3661 caccttggcc ttttcggagc agggtctcct taagtccatt cagcttactc aggatagccc
     3721 acatgtaccg gtgcacttca agttcctcaa gtatggcgtt cgatcgcatg gcgatagatc
     3781 cggtgcctat ctgttcctgc ccaatggacc agcttcgcca gtcgagcttg gccagccagt
     3841 ggtcctggtg actaagggca aactggagtc gtccgtgagc gtgggacttc cgagcgtggt
     3901 gcaccagacg ataatgcgcg gtggtgcacc tgagattcgc aatctggtgg atataggctc
     3961 actggacaac acggagatcg tgatgcgctt ggagacgcat atcgacagcg gcgatatctt
     4021 ctacacggat ctcaatggat tgcaatttat caagaggcgg cgtttggaca aattaccttt
     4081 gcaggccaac tattatccca taccttctgg tatgttcatt gaggatgcca atacgcgact
     4141 cactctcctc acgggtcaac cgctgggtgg atcttctctg gcctcgggcg agctagagat
     4201 tatgcaagat cgtcgcctgg ccagcgatga tgaacgcggc ctgggacagg gtgttttgga
     4261 caacaagccg gtgctgcata tttatcggct ggtgctggag aaggttaaca actgtgtccg
     4321 accgtcagag cttcatcctg ccggctattt gacaagtgcc gctcacaaag catcgcagtc
     4381 actgctggat ccactggaca agtttatatt cgctgaaaat gagtggatcg gggcacaggg
     4441 gcaatttggt ggcgatcatc cttcggctcg tgaggatctc gatgtgtcgg tgatgagacg
     4501 cttaaccaag agctcggcca aaacccagcg agtaggctac gttctgcacc gcaccaatct
     4561 gatgcaatgc ggcactccag aggagcatac acagaaggtg agcttagaag tttattatat
     4621 attaatatca aagaaagtga aatggtattt atttataatt aacaatattg tttgactaat
     4681 tgttcgttcg tcagctggat gtgtgccacc tactgccgaa tgtggcgaga tgcgagcgca
     4741 cgacgctgac tttcctgcag aatttggagc acttggatgg catggtggcg ccggaagtgt
     4801 gccccatgga aaccgccgct tatgtgagca gtcactcaag ctgatcgcaa cgtgttatgg
     4861 caaaggataa agcagaaact gaagccaagc gaccatctca caacctatga atctcggacg
     4921 ctaatccact gcaatacagg caatcttcgt ttaatgttcg acttaagcac tgactgcacc
     4981 gaaagacgta atgcgtaatc catactacgt atcatttatt tattcaagct tccacacgag
     5041 ggtttggaaa ttcaatccta tgacgcagcg gtgtattttt cgcacccccg tgtaactaca
     5101 cgttttactc tgtttcccct agttttttac gtttttttgt gatatccatc cagtcccaca
     5161 gcaaggcaat acatgtctgt actcgatatc cccaatgggg ttttattgcc tataacaatg
     5221 aatcgtaact ataactaacg tttaactgta aagtaggctt agtgataatg acgcaactgc
     5281 gactgcaatg atattaatct cgacgtttgt tttttacaaa ttgaataaaa ttgagtctca
     5341 tttagaatcg acttttacgt tgctattcta aactaaaaac ataacgtctc tttttattcg
     5401 aaaaaggaaa ggatttgtat tactattcaa aattcgtcat tttggcttta gttagaatcg
     5461 tgttgttggt aagttatgaa ttgcactttc tattgaatat ttaatttttc tcagtaaatc
     5521 taaaataaat acattttaat ttaattttta agattagatt taattttttt tttaatattg
     5581 taagtaatga atgttagtaa acagttgatc tttgtattat taagttttga atttatgtgg
     5641 attatgaaac gagcttttga gacgactaat taaagccata atcatgagtt atagttttag
     5701 tggatgaaaa acagaatgca atcttatcag ctccagtgcg gggtactatt attgccagaa
     5761 gacctacaga gatgagatac taagagcgcg gaattggaaa atgcacaatg gaaatggaaa
     5821 tccggattga gtgtaaagtg gttgttttgg atagagagcg aatcgtgcgc agttcgctct
     5881 cttcaaaatc cgaaacgagc aacgaaagca aaaccgaatc cgaatcggaa tccgaaa
//